PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00011403001
Common NameGSBRNA2T00011403001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ZF-HD
Protein Properties Length: 258aa    MW: 29359.2 Da    PI: 9.9121
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00011403001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer89.14.1e-2874129258
          ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                          ++vrY+eC++NhAas Ggh++D Cg fm+s geegta++l CaAC+CHR+FHR e +
  GSBRNA2T00011403001  74 RSVRYRECQRNHAASSGGHVIDVCGKFMSS-GEEGTAESLLCAACDCHRSFHRNEID 129
                          579**************************9.999*******************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-3162138IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047705.6E-2776128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.0E-2677128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.92378127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.2E-28186255IPR009057Homeodomain-like
SuperFamilySSF466892.72E-19186254IPR009057Homeodomain-like
PROSITE profilePS500719.718191255IPR001356Homeobox domain
TIGRFAMsTIGR015651.4E-27193250IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGDGKTKIIS KSSNPRSLYS SVHLLPNHRQ RETHKSITIS NGSNLDLDLD TNPISFAAPA  60
PRSYVRLQTT SPTRSVRYRE CQRNHAASSG GHVIDVCGKF MSSGEEGTAE SLLCAACDCH  120
RSFHRNEIDG MFVVKFNSFG HSPRPLVSRH VSPIMMSFAR GGRDPAESST EDVNKFHQYF  180
CGNGVDQSQY HPKKRFRTKF NQEQKEKMEE FAEKIGWRMS KPEDSEVNLF CREINLKRQL  240
FKVWMHNNKQ TAKKKEM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-181942521876ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596192.11e-180PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW71e-117ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A078JWH80.0A0A078JWH8_BRANA; BnaCnng71430D protein
STRINGBra037224.1-P1e-130(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-118homeobox protein 24
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]